PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000111.1_g00067.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 320aa    MW: 35583.6 Da    PI: 10.041
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000111.1_g00067.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB83.42.8e-26173220249
                    NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtse 49 
                              reqdrflPian+srimkk+lPa +ki+kdaketvqecvsefisfvtse
  Itr_sc000111.1_g00067.1 173 REQDRFLPIANISRIMKKALPASGKIAKDAKETVQECVSEFISFVTSE 220
                              89*********************************************9 PP

2NF-YB75.11e-232422875095
                    NF-YB  50 asdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                              asdkcq+ekrktingddllwa+atlGfedy++plkvyl++yre ++
  Itr_sc000111.1_g00067.1 242 ASDKCQKEKRKTINGDDLLWAMATLGFEDYIDPLKVYLTRYREGDT 287
                              9*****************************************9665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.3E-46169299IPR009072Histone-fold
SuperFamilySSF471131.14E-31175300IPR009072Histone-fold
PfamPF008081.5E-15178220IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.0E-17206224No hitNo description
PRINTSPR006157.0E-17246264No hitNo description
PRINTSPR006157.0E-17265283No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MLKAQRRSGQ IFKALISPLR LASKCRNRSL EDLPRSTLCL TDLEFHVKRA RKVRENLPGM  60
DRVVESWSEC CTLESGEAKS VNHGDGKAEV RRAGEGVRVE RHRLEKSSPL CALFQRPISS  120
PRLDSPRAQI QILNFSDRVH LAAVMADGQH PASPGGGSHD SGEHSPGPRS NIREQDRFLP  180
IANISRIMKK ALPASGKIAK DAKETVQECV SEFISFVTSE YGSPRKLFSS LLFSLKVMRI  240
WASDKCQKEK RKTINGDDLL WAMATLGFED YIDPLKVYLT RYREGDTKGS AKASDGSSRD  300
AVPNPNSQGQ HIAVPMRGME
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B4e-39171284294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-39171284294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003554361.18e-80PREDICTED: nuclear transcription factor Y subunit B-10-like
SwissprotQ8VYK44e-62NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A0B2PJ973e-81A0A0B2PJ97_GLYSO; Nuclear transcription factor Y subunit B-8 (Fragment)
STRINGGLYMA19G36220.21e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.77e-64nuclear factor Y, subunit B1